PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla022831
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family CO-like
Protein Properties Length: 321aa    MW: 35572.1 Da    PI: 7.4599
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla022831genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.52e-061553337
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.....H 37
               ++ C  +++   +lfC+ +  +lC  C +++H       H
  Cla022831 15 KPLCYSCKSATPTLFCRHDTAFLCLRCDFQIH-TlsgtrH 53
               679******99*********************.3344556 PP

2zf-B_box26.31.5e-085698339
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.......Htv 39
                + C+ +e+ ++++ C+ +   lC++C   +H +       H++
  Cla022831 56 VWLCEVCEQAPATITCNADAAALCPSCDADIH-SvnplarrHDR 98
               689*****************************.33566666765 PP

3CCT69.58.9e-24246290145
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae RpRvKGrFvk++e
  Cla022831 246 REARVLRYREKKKNRKFEKTIRYASRKAYAEIRPRVKGRFVKRSE 290
                9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.1151358IPR000315B-box-type zinc finger
SMARTSM003360.0481348IPR000315B-box-type zinc finger
CDDcd000212.09E-61658No hitNo description
SMARTSM003366.8E-1154101IPR000315B-box-type zinc finger
PROSITE profilePS501199.37154101IPR000315B-box-type zinc finger
PfamPF006439.6E-75699IPR000315B-box-type zinc finger
CDDcd000214.83E-55788No hitNo description
PROSITE profilePS5101716.479246288IPR010402CCT domain
PfamPF062039.4E-18246288IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MHSFAAGWPG VATAKPLCYS CKSATPTLFC RHDTAFLCLR CDFQIHTLSG TRHPRVWLCE  60
VCEQAPATIT CNADAAALCP SCDADIHSVN PLARRHDRSA IQPFYDSPPS ASVASVFKFL  120
LPTQHHHDVV QPDLKSEDIF FSEMDSLIDF DYPTTGDGVV PDESNPGTES TTPPTDYSTR  180
NFCGFELFST RSKLHNISYP SQNLSHSVSS SSLDVGVVPD RNTASDASFP EGQMAEKAVQ  240
LRGMDREARV LRYREKKKNR KFEKTIRYAS RKAYAEIRPR VKGRFVKRSE TNCEIDRIYA  300
GAGVGFMVSE GQYGVVPSLG V
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008451877.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH81e-84COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0A0LK830.0A0A0A0LK83_CUCSA; Uncharacterized protein
STRINGGLYMA13G01290.14e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2486733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-81CONSTANS-like 5